Lineage for d1jzta_ (1jzt A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.104: YjeF N-terminal domain-like [64152] (1 superfamily)
3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 32145678; strand 8 is antiparallel to the restSuperfamily c.104.1: YjeF N-terminal domain-like [64153] (2 families) 
possible circular permutation of the ribokinase-like fold (of the YjeF C-terminal domain)Family c.104.1.1: YjeF N-terminal domain-like [64154] (2 proteins) 
Protein Hypothetical protein YNL200c (YNU0_YEAST) [64155] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64156] (1 PDB entry) 
Domain d1jzta_: 1jzt A: [63319]
structural genomics
complexed with cl
Details for d1jzta_
PDB Entry: 1jzt (more details), 1.94 Å
PDB Description: crystal structure of yeast ynu0, ynl200c
PDB Compounds: (A:) Hypothetical 27.5 kDa protein in SPX19-GCR2 intergenic regionSCOPe Domain Sequences for d1jzta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jzta_ c.104.1.1 (A:) Hypothetical protein YNL200c (YNU0_YEAST) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lkvvssklaaeidkelmgpqigftlqqlmelagfsvaqavcrqfplrgktetekgkhvfv
iagpgnnggdglvcarhlklfgynpvvfypkrsertefykqlvhqlnffkvpvlsqdegn
wleylkpektlcivdaifgfsfkppmrepfkgiveelckvqniipivsvdvptgwdvdkg
pisqpsinpavlvsltvpkpcsshirenqtthyvggrfiprdfankfgfepfgyestdqi
lkl
SCOPe Domain Coordinates for d1jzta_:
Click to download the PDB-style file with coordinates for d1jzta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jzta_:
- d1jzta_ first appeared in SCOP 1.57
- d1jzta_ appears in SCOPe 2.06
- d1jzta_ appears in the current release, SCOPe 2.08
View in 3D
