Lineage for d1jsya2 (1jsy A:176-399)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770834Family b.1.18.11: Arrestin/Vps26-like [81291] (2 proteins)
  6. 1770835Protein Arrestin [49244] (3 species)
    duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head
  7. 1770836Species Cow (Bos taurus), beta-arrestin 1 [TaxId:9913] [69169] (6 PDB entries)
  8. 1770848Domain d1jsya2: 1jsy A:176-399 [71848]

Details for d1jsya2

PDB Entry: 1jsy (more details), 2.9 Å

PDB Description: Crystal structure of bovine arrestin-2
PDB Compounds: (A:) Bovine arrestin-2 (full length)

SCOPe Domain Sequences for d1jsya2:

Sequence, based on SEQRES records: (download)

>d1jsya2 b.1.18.11 (A:176-399) Arrestin {Cow (Bos taurus), beta-arrestin 1 [TaxId: 9913]}
erpgpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisv
rqyadiclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkh
edtnlasstllreganreilgiivsykvkvklvvsrggllgdlassdvavelpftlmhpk
pkeepphrevpehetpvdtnlieldtndddivfedfarqrlkgm

Sequence, based on observed residues (ATOM records): (download)

>d1jsya2 b.1.18.11 (A:176-399) Arrestin {Cow (Bos taurus), beta-arrestin 1 [TaxId: 9913]}
erpgpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisv
rqyadiclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkh
edtnlasstllreganreilgiivsykvkvklvvsssdvavelpftlmhpkdddivfedf
arqrlkgm

SCOPe Domain Coordinates for d1jsya2:

Click to download the PDB-style file with coordinates for d1jsya2.
(The format of our PDB-style files is described here.)

Timeline for d1jsya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jsya1