| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.2: D-glucarate dehydratase-like [51609] (14 proteins) |
| Protein L-Ala-D/L-Glu epimerase [69397] (2 species) |
| Species Bacillus subtilis [TaxId:1423] [69399] (2 PDB entries) Uniprot O34508 |
| Domain d1jpma1: 1jpm A:126-359 [67031] Other proteins in same PDB: d1jpma2, d1jpmb2, d1jpmc2, d1jpmd2 complexed with gol, mg |
PDB Entry: 1jpm (more details), 2.25 Å
SCOPe Domain Sequences for d1jpma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]}
yrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirkrvgsa
vklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtpimade
svftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmietklgit
aaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaal
Timeline for d1jpma1: