Lineage for d1jowa1 (1jow A:9-148)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.74: Cyclin-like [47953] (1 superfamily)
core: 5 helices; one helix is surrounded by the othersSuperfamily a.74.1: Cyclin-like [47954] (4 families) 
duplication: consists of two domains of this foldFamily a.74.1.1: Cyclin [47955] (9 proteins) 
Protein Viral cyclin [47961] (3 species) 
Species Herpesvirus saimiri [TaxId:10381] [47962] (7 PDB entries) 
Domain d1jowa1: 1jow A:9-148 [66998]
Other proteins in same PDB: d1jowb_
Details for d1jowa1
PDB Entry: 1jow (more details), 3.1 Å
PDB Description: Crystal structure of a complex of human CDK6 and a viral cyclin
PDB Compounds: (A:) cyclin homologSCOPe Domain Sequences for d1jowa1:
Sequence, based on SEQRES records: (download)
>d1jowa1 a.74.1.1 (A:9-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
nrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfel
dksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylscdcft
nlelinqekdilealkwdte
Sequence, based on observed residues (ATOM records): (download)
>d1jowa1 a.74.1.1 (A:9-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
nrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfel
dksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylsftnle
linqekdilealkwdte
SCOPe Domain Coordinates for d1jowa1:
Click to download the PDB-style file with coordinates for d1jowa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jowa1:
- d1jowa1 first appeared in SCOP 1.59
- d1jowa1 appears in SCOPe 2.07
View in 3D
