Lineage for d1jk7a_ (1jk7 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938246Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1938247Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1938325Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 1938351Protein Protein phosphatase-1 (PP-1) [56311] (5 species)
  7. 1938362Species Human (Homo sapiens), beta isoform [TaxId:9606] [64430] (7 PDB entries)
    Uniprot P36873
  8. 1938363Domain d1jk7a_: 1jk7 A: [63144]
    complexed with bme, mn, oka, so4

Details for d1jk7a_

PDB Entry: 1jk7 (more details), 1.9 Å

PDB Description: crystal structure of the tumor-promoter okadaic acid bound to protein phosphatase-1
PDB Compounds: (A:) serine/threonine protein phosphatase pp1-gamma catalytic subunit

SCOPe Domain Sequences for d1jk7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]}
klnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdi
hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnh
ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
irrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlic
rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

SCOPe Domain Coordinates for d1jk7a_:

Click to download the PDB-style file with coordinates for d1jk7a_.
(The format of our PDB-style files is described here.)

Timeline for d1jk7a_: