Lineage for d1je6a2 (1je6 A:0-180)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimericSuperfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) 
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) 
Protein Class I MHC homolog [54489] (4 species)
gamma, delta T-cell ligand
Species Human (Homo sapiens), Mic-b [TaxId:9606] [75380] (1 PDB entry) 
Domain d1je6a2: 1je6 A:0-180 [71639]
Other proteins in same PDB: d1je6a1
complexed with so4
Details for d1je6a2
PDB Entry: 1je6 (more details), 2.5 Å
PDB Description: structure of the mhc class i homolog micb
PDB Compounds: (A:) MHC class I chain-related proteinSCOPe Domain Sequences for d1je6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1je6a2 d.19.1.1 (A:0-180) Class I MHC homolog {Human (Homo sapiens), Mic-b [TaxId: 9606]}
mephslrynlmvlsqdgsvqsgflaeghldgqpflrydrqkrrakpqgqwaedvlgaetw
dtetedltengqdlrrtlthikdqkgglhslqeirvceihedsstrgsrhfyyngelfls
qnletqestvpqssraqtlamnvtnfwkedamktkthyramqadclqklqrylksgvair
r
SCOPe Domain Coordinates for d1je6a2:
Click to download the PDB-style file with coordinates for d1je6a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1je6a2:
- d1je6a2 first appeared in SCOP 1.61
- d1je6a2 appears in SCOPe 2.07
View in 3D
