Class b: All beta proteins [48724] (176 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.1: NADPH-cytochrome p450 reductase FAD-binding domain-like [50438] (4 proteins) there is an alpha-helical subdomain inserted in this domain automatically mapped to Pfam PF00667 |
Protein NADPH-cytochrome p450 reductase [50439] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [50440] (4 PDB entries) |
Domain d1ja1a1: 1ja1 A:240-518 [62803] Other proteins in same PDB: d1ja1a2, d1ja1a3, d1ja1b2, d1ja1b3 complexed with epe, fad, fmn, nap; mutant |
PDB Entry: 1ja1 (more details), 1.8 Å
SCOPe Domain Sequences for d1ja1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ja1a1 b.43.4.1 (A:240-518) NADPH-cytochrome p450 reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]} ssirqyelvvhedmdvakvytgemgrlksyenqkppfdaknpflaavtanrklnqgterh lmhleldisdskiryesgdhvavypandsalvnqigeilgadldvimslnnldeesnkkh pfpcpttyrtaltyylditnpprtnvlyelaqyasepseqehlhkmasssgegkelylsw vvearrhilailqdypslrppidhlcellprlqaryyaiassskvhpnsvhicavaveye aksgrvnkgvatswlrakepagenggralvpmfvrksqf
Timeline for d1ja1a1: