Lineage for d1j1ya_ (1j1y A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
core: beta-alpha-beta(4); 2 layers: alpha/betaSuperfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) 
Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) 
Protein Phenylacetic acid degradation protein PaaI [89903] (2 species) Species Thermus thermophilus [TaxId:274] [102909] (1 PDB entry) 
Domain d1j1ya_: 1j1y A: [90776]
complexed with cl, mg
Details for d1j1ya_
PDB Entry: 1j1y (more details), 1.7 Å
PDB Description: Crystal Structure of PaaI from Thermus thermophilus HB8
PDB Compounds: (A:) PaaI proteinSCOPe Domain Sequences for d1j1ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j1ya_ d.38.1.5 (A:) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]}
rdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpa
valscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl
SCOPe Domain Coordinates for d1j1ya_:
Click to download the PDB-style file with coordinates for d1j1ya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j1ya_:
- d1j1ya_ first appeared in SCOP 1.67
- d1j1ya_ appears in SCOPe 2.04
- d1j1ya_ appears in SCOPe 2.06
- d1j1ya_ appears in the current release, SCOPe 2.08
View in 3D
