Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins) |
Protein Malate dehydrogenase [51849] (12 species) |
Species Thermus thermophilus [TaxId:274] [82300] (5 PDB entries) identical sequence to that from the Thermus flavus enzyme |
Domain d1iz9a1: 1iz9 A:1-154 [76984] Other proteins in same PDB: d1iz9a2, d1iz9b2 |
PDB Entry: 1iz9 (more details), 2 Å
SCOP Domain Sequences for d1iz9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iz9a1 c.2.1.5 (A:1-154) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc afpllagleatddpkvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva kkdvkvlvvgnpantnaliayknapglnprnfta
Timeline for d1iz9a1: