Lineage for d1iw7a2 (1iw7 A:50-172)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684390Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 1684391Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 1684392Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 1684393Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 1684408Species Thermus thermophilus [TaxId:274] [75595] (14 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 1684441Domain d1iw7a2: 1iw7 A:50-172 [71471]
    Other proteins in same PDB: d1iw7a1, d1iw7b1, d1iw7c_, d1iw7d_, d1iw7e_, d1iw7f1, d1iw7f2, d1iw7f3, d1iw7k1, d1iw7l1, d1iw7m_, d1iw7n_, d1iw7o_, d1iw7p1, d1iw7p2, d1iw7p3
    complexed with mg, pb

Details for d1iw7a2

PDB Entry: 1iw7 (more details), 2.6 Å

PDB Description: Crystal structure of the RNA polymerase holoenzyme from Thermus thermophilus at 2.6A resolution
PDB Compounds: (A:) RNA polymerase alpha subunit

SCOPe Domain Sequences for d1iw7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iw7a2 d.181.1.1 (A:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOPe Domain Coordinates for d1iw7a2:

Click to download the PDB-style file with coordinates for d1iw7a2.
(The format of our PDB-style files is described here.)

Timeline for d1iw7a2: