Lineage for d1iv7a_ (1iv7 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.17: Cystatin-like [54402] (7 superfamilies)
Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) 
has a additional strand at the N-terminusFamily d.17.1.1: Monellin [54404] (2 proteins) 
Protein Monellin, B & A chains together [54405] (1 species) Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (12 PDB entries) 
Domain d1iv7a_: 1iv7 A: [90707]
single-chain version
Details for d1iv7a_
PDB Entry: 1iv7 (more details), 1.82 Å
PDB Description: crystal structure of single chain monellin
PDB Compounds: (A:) monellinSCOPe Domain Sequences for d1iv7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iv7a_ d.17.1.1 (A:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenegfreikgyey
qlyvyasdklfradisedyktrgrkllrfngpvppp
SCOPe Domain Coordinates for d1iv7a_:
Click to download the PDB-style file with coordinates for d1iv7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iv7a_:
- d1iv7a_ first appeared in SCOP 1.67
- d1iv7a_ appears in SCOPe 2.07
View in 3D
