PDB entry 1iv7

View 1iv7 on RCSB PDB site
Description: Crystal Structure of Single Chain Monellin
Class: plant protein
Keywords: alpha+beta, plant protein
Deposited on 2002-03-15, released 2003-10-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.202
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monellin
    Species: Dioscoreophyllum cumminsii [TaxId:3457]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02882
      • engineered (48-49)
      • linker (50)
    • Uniprot P02881
    Domains in SCOPe 2.06: d1iv7a_
  • Chain 'B':
    Compound: monellin
    Species: Dioscoreophyllum cumminsii [TaxId:3457]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02882 (0-49)
      • engineered (48-49)
      • linker (50)
    • Uniprot P02881 (51-95)
    Domains in SCOPe 2.06: d1iv7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iv7A (A:)
    geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenegfreikgyey
    qlyvyasdklfradisedyktrgrkllrfngpvppp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iv7B (B:)
    geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenegfreikgyey
    qlyvyasdklfradisedyktrgrkllrfngpvppp