PDB entry 1iv7

View 1iv7 on RCSB PDB site
Description: Crystal Structure of Single Chain Monellin
Class: plant protein
Keywords: alpha+beta, plant protein
Deposited on 2002-03-15, released 2003-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: monellin
  Species: Dioscoreophyllum cumminsii [TaxId:3457]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02882
    • engineered (48-49)
    • linker (50)
  • Uniprot P02881
  Domains in SCOPe 2.08: d1iv7a_
• Chain 'B':
  Compound: monellin
  Species: Dioscoreophyllum cumminsii [TaxId:3457]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02882 (0-49)
    • engineered (48-49)
    • linker (50)
  • Uniprot P02881 (51-95)
  Domains in SCOPe 2.08: d1iv7b_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iv7A (A:)
  geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenegfreikgyey
  qlyvyasdklfradisedyktrgrkllrfngpvppp
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iv7B (B:)
  geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenegfreikgyey
  qlyvyasdklfradisedyktrgrkllrfngpvppp