Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.8: CoA-binding domain [51900] (6 proteins) |
Protein Hypothetical protein TT1466 [89542] (1 species) putative CoA-binding protein |
Species Thermus thermophilus [TaxId:274] [89543] (2 PDB entries) |
Domain d1iuka_: 1iuk A: [83712] structural genomics; native protein |
PDB Entry: 1iuk (more details), 1.7 Å
SCOPe Domain Sequences for d1iuka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} mndqelraylsqaktiavlgahkdpsrpahyvprylreqgyrvlpvnprfqgeelfgeea vaslldlkepvdildvfrppsalmdhlpevlalrpglvwlqsgirhpefekalkeagipv vadrclmvehkrlfrg
Timeline for d1iuka_: