SCOPe 2.04: Domain d1iuka_: 1iuk A:

Lineage for d1iuka_ (1iuk A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.8: CoA-binding domain [51900] (6 proteins)

6. Protein Hypothetical protein TT1466 [89542] (1 species)
   putative CoA-binding protein

7. Species Thermus thermophilus [TaxId:274] [89543] (2 PDB entries)

8. Domain d1iuka_: 1iuk A: [83712]
   structural genomics; native protein

Details for d1iuka_

PDB Entry: 1iuk, 1.7 Å

PDB Description: The structure of native ID.343 from Thermus thermophilus

PDB Compounds: (A:) hypothetical protein TT1466

SCOPe Domain Sequences for d1iuka_:

Sequence; same for both SEQRES and ATOM records:

>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]}
mndqelraylsqaktiavlgahkdpsrpahyvprylreqgyrvlpvnprfqgeelfgeea
vaslldlkepvdildvfrppsalmdhlpevlalrpglvwlqsgirhpefekalkeagipv
vadrclmvehkrlfrg

Timeline for d1iuka_:

• d1iuka_ first appeared in SCOP 1.65
  
• d1iuka_ appears in SCOPe 2.03
  
• d1iuka_ appears in SCOPe 2.05
  
• d1iuka_ appears in the current release, SCOPe 2.08