Lineage for d1iufa2 (1iuf A:76-141)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761140Superfamily a.4.1: Homeodomain-like [46689] (19 families) (S)
    consists only of helices
  5. 761479Family a.4.1.7: Centromere-binding [46756] (2 proteins)
    duplication: tandem repeat of two similar domains
  6. 761480Protein Ars-binding protein 1, ABP1 [74670] (1 species)
  7. 761481Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [74671] (1 PDB entry)
  8. 761483Domain d1iufa2: 1iuf A:76-141 [71440]
    low resolution solution structure

Details for d1iufa2

PDB Entry: 1iuf (more details)

PDB Description: low resolution solution structure of the two dna-binding domains in schizosaccharomyces pombe abp1 protein
PDB Compounds: (A:) centromere abp1 protein

SCOP Domain Sequences for d1iufa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iufa2 a.4.1.7 (A:76-141) Ars-binding protein 1, ABP1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
ppkyplleaalfewqvqqgddatlsgetikraaailwhkipeyqdqpvpnfsngwlegfr
krhilh

SCOP Domain Coordinates for d1iufa2:

Click to download the PDB-style file with coordinates for d1iufa2.
(The format of our PDB-style files is described here.)

Timeline for d1iufa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iufa1