Lineage for d1iufa2 (1iuf A:76-141)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (19 families) 
consists only of helices
Family a.4.1.7: Centromere-binding [46756] (2 proteins)
duplication: tandem repeat of two similar domains
Protein Ars-binding protein 1, ABP1 [74670] (1 species) Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [74671] (1 PDB entry) 
Domain d1iufa2: 1iuf A:76-141 [71440]
low resolution solution structure
Details for d1iufa2
PDB Entry: 1iuf (more details)
PDB Description: low resolution solution structure of the two dna-binding domains in schizosaccharomyces pombe abp1 protein
PDB Compounds: (A:) centromere abp1 proteinSCOP Domain Sequences for d1iufa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iufa2 a.4.1.7 (A:76-141) Ars-binding protein 1, ABP1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
ppkyplleaalfewqvqqgddatlsgetikraaailwhkipeyqdqpvpnfsngwlegfr
krhilh
SCOP Domain Coordinates for d1iufa2:
Click to download the PDB-style file with coordinates for d1iufa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iufa2:
- d1iufa2 first appeared in SCOP 1.61
- d1iufa2 appears in SCOP 1.73
- d1iufa2 appears in SCOPe 2.01
- d1iufa2 appears in the current release, SCOPe 2.08
View in 3D
