Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) contains an additional N-terminal strand |
Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (4 proteins) consist of a single subdomain automatically mapped to Pfam PF02883 |
Protein Gamma1-adaptin domain [74858] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [74859] (4 PDB entries) |
Domain d1iu1b_: 1iu1 B: [71429] |
PDB Entry: 1iu1 (more details), 1.8 Å
SCOPe Domain Sequences for d1iu1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iu1b_ b.1.10.2 (B:) Gamma1-adaptin domain {Human (Homo sapiens) [TaxId: 9606]} iaagipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqaavpktfq lqllspsssivpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnfppq swq
Timeline for d1iu1b_: