Lineage for d1iu0a_ (1iu0 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2056344Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2056345Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2056346Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2056571Protein Synaptic protein PSD-95 [50162] (2 species)
    Synonym: synapse associated protein 90, sap90
    duplication: contains three PDZ domains
  7. 2056574Species Norway rat (Rattus norvegicus) [TaxId:10116] [50163] (12 PDB entries)
    Uniprot P31016 62-154
  8. 2056585Domain d1iu0a_: 1iu0 A: [83707]
    first PDZ domain

Details for d1iu0a_

PDB Entry: 1iu0 (more details)

PDB Description: the first pdz domain of psd-95
PDB Compounds: (A:) psd-95

SCOPe Domain Sequences for d1iu0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iu0a_ b.36.1.1 (A:) Synaptic protein PSD-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
meyeeitlergnsglgfsiaggtdnphigddpsifitkiipggaaaqdgrlrvndsilfv
nevdvrevthsaavealkeagsivrlyvmrr

SCOPe Domain Coordinates for d1iu0a_:

Click to download the PDB-style file with coordinates for d1iu0a_.
(The format of our PDB-style files is described here.)

Timeline for d1iu0a_: