Lineage for d1ilva_ (1ilv A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.106: SurE-like [64166] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7Superfamily c.106.1: SurE-like [64167] (2 families) 
some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family
Family c.106.1.1: SurE-like [64168] (2 proteins) Protein SurE homolog TM1662 [64169] (1 species)
has a phosphatase activitySpecies Thermotoga maritima [TaxId:2336] [64170] (4 PDB entries) 
Domain d1ilva_: 1ilv A: [66206]
structural genomics; target TM107
Details for d1ilva_
PDB Entry: 1ilv (more details), 2 Å
PDB Description: crystal structure analysis of the tm107
PDB Compounds: (A:) stationary-phase survival protein sure homologSCOPe Domain Sequences for d1ilva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ilva_ c.106.1.1 (A:) SurE homolog TM1662 {Thermotoga maritima [TaxId: 2336]}
mrilvtnddgiqskgiivlaellseehevfvvapdkersatghsitihvplwmkkvfise
rvvaysttgtpadcvklaynvvmdkrvdlivsgvnrgpnmgmdilhsgtvsgamegammn
ipsiaissanyespdfegaarflidflkefdfslldpftmlninvpageikgwrftrqsr
rrwndyfeervspfgekyywmmgeviedddrddvdykavregyvsitpihpfltneqclk
klrevy
SCOPe Domain Coordinates for d1ilva_:
Click to download the PDB-style file with coordinates for d1ilva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ilva_:
- d1ilva_ first appeared in SCOP 1.59
- d1ilva_ appears in SCOPe 2.06
- d1ilva_ appears in the current release, SCOPe 2.08
View in 3D
