Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
Protein Exonuclease domain of family B DNA polymerases [53125] (8 species) elaborated with additional structures and the N-terminal subdomain |
Species Bacteriophage RB69 [TaxId:12353] [53127] (93 PDB entries) additional N-terminal subdomain contains rudimental OB-fold and rudimental ferredoxin-like fold |
Domain d1ih7a1: 1ih7 A:1-375 [62375] Other proteins in same PDB: d1ih7a2 complexed with gmp, k has additional subdomain(s) that are not in the common domain |
PDB Entry: 1ih7 (more details), 2.21 Å
SCOPe Domain Sequences for d1ih7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ih7a1 c.55.3.5 (A:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69 [TaxId: 12353]} mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfdipyvynriknifgestak rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv gklkydgpisklresnhqryisyniidvyrvlqidakrqfinlsldmgyyakiqiqsvfs piktwdaiifnslke
Timeline for d1ih7a1: