Lineage for d1icha_ (1ich A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772704Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 772705Superfamily a.77.1: DEATH domain [47986] (4 families) (S)
  5. 772706Family a.77.1.2: DEATH domain, DD [81312] (8 proteins)
    Pfam PF00531
  6. 772742Protein Tumor necrosis factor receptor-1 death domain [74741] (1 species)
  7. 772743Species Human (Homo sapiens) [TaxId:9606] [74742] (1 PDB entry)
  8. 772744Domain d1icha_: 1ich A: [71182]
    mutant

Details for d1icha_

PDB Entry: 1ich (more details)

PDB Description: solution structure of the tumor necrosis factor receptor-1 death domain
PDB Compounds: (A:) tumor necrosis factor receptor-1

SCOP Domain Sequences for d1icha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1icha_ a.77.1.2 (A:) Tumor necrosis factor receptor-1 death domain {Human (Homo sapiens) [TaxId: 9606]}
patlyavvenvpplrwkefvkrlglsdheidrlelqngrclreaqysmlatwrrrtprre
atlellgrvlrdmdllgcledieealc

SCOP Domain Coordinates for d1icha_:

Click to download the PDB-style file with coordinates for d1icha_.
(The format of our PDB-style files is described here.)

Timeline for d1icha_: