Lineage for d1i9wa1 (1i9w A:293-380)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.18: E set domains [81296] (23 families) 
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins) Protein Fusion glycoprotein E1 [74840] (1 species) Species Semliki forest virus [TaxId:11033] [74841] (4 PDB entries) 
Domain d1i9wa1: 1i9w A:293-380 [71163]
Other proteins in same PDB: d1i9wa2
Details for d1i9wa1
PDB Entry: 1i9w (more details), 3 Å
PDB Description: crystal structure of the fusion glycoprotein e1 from semliki forest virus
PDB Compounds: (A:) fusion protein e1SCOP Domain Sequences for d1i9wa1:
Sequence, based on SEQRES records: (download)
>d1i9wa1 b.1.18.4 (A:293-380) Fusion glycoprotein E1 {Semliki forest virus [TaxId: 11033]}
aptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagkv
tlhfstasaspsfvvslcsaratcsasc
Sequence, based on observed residues (ATOM records): (download)
>d1i9wa1 b.1.18.4 (A:293-380) Fusion glycoprotein E1 {Semliki forest virus [TaxId: 11033]}
aptiidltctvatcthsvltltyktnkngdcsvhshsnvatlqeatakvtlhfstasasp
sfvvslcsaratcsasc
SCOP Domain Coordinates for d1i9wa1:
Click to download the PDB-style file with coordinates for d1i9wa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i9wa1:
- d1i9wa1 first appeared in SCOP 1.61
- d1i9wa1 appears in SCOP 1.73
- d1i9wa1 appears in SCOPe 2.01
- d1i9wa1 appears in the current release, SCOPe 2.08
View in 3D
