Lineage for d1i6ob_ (1i6o B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 994891Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 994912Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 994913Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins)
  6. 994914Protein beta-carbonic anhydrase [53058] (4 species)
  7. 994915Species Escherichia coli [TaxId:562] [64085] (3 PDB entries)
    Uniprot P61517
  8. 994918Domain d1i6ob_: 1i6o B: [61847]
    complexed with zn

Details for d1i6ob_

PDB Entry: 1i6o (more details), 2.2 Å

PDB Description: crystal structure of e. coli beta carbonic anhydrase (ecca)
PDB Compounds: (B:) carbonic anhydrase

SCOPe Domain Sequences for d1i6ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6ob_ c.53.2.1 (B:) beta-carbonic anhydrase {Escherichia coli [TaxId: 562]}
kdidtlisnnalwskmlveedpgffeklaqaqkprflwigcsdsrvpaerltglepgelf
vhrnvanlvihtdlnclsvvqyavdvlevehiiicghygcggvqaavenpelglinnwll
hirdiwfkhssllgempqerrldtlcelnvmeqvynlghstimqsawkrgqkvtihgway
gihdgllrdldvtatnretleqryrhgisnlklk

SCOPe Domain Coordinates for d1i6ob_:

Click to download the PDB-style file with coordinates for d1i6ob_.
(The format of our PDB-style files is described here.)

Timeline for d1i6ob_: