Lineage for d1i4ua_ (1i4u A:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily)
barrel, closed or opened; n=8, S=12; meanderSuperfamily b.60.1: Lipocalins [50814] (10 families) 
bind hydrophobic ligands in their interiorFamily b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
barrel, closed; n=8, S=12, meander
Protein Alpha-crustacyanin [63807] (1 species) Species European lobster (Homarus gammarus) [TaxId:6707] [63808] (7 PDB entries) 
Domain d1i4ua_: 1i4u A: [61732]
C1 subunit
complexed with mpd, so4
Details for d1i4ua_
PDB Entry: 1i4u (more details), 1.15 Å
PDB Description: the c1 subunit of alpha-crustacyanin
PDB Compounds: (A:) crustacyaninSCOPe Domain Sequences for d1i4ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i4ua_ b.60.1.1 (A:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]}
dkipdfvvpgkcasvdrnklwaeqtpnrnsyagvwyqfaltnnpyqliekcvrneysfdg
kqfviestgiaydgnllkrngklypnpfgephlsidyensfaaplviletdysnyaclys
cidynfgyhsdfsfifsrsanladqyvkkceaafkninvdttrfvktvqgsscpydtqkt
l
SCOPe Domain Coordinates for d1i4ua_:
Click to download the PDB-style file with coordinates for d1i4ua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i4ua_:
- d1i4ua_ first appeared in SCOP 1.57
- d1i4ua_ appears in SCOPe 2.06
- d1i4ua_ appears in the current release, SCOPe 2.08
View in 3D
