![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
![]() | Superfamily d.6.1: Prion-like [54098] (1 family) ![]() |
![]() | Family d.6.1.1: Prion-like [54099] (3 proteins) |
![]() | Protein Prion protein domain [54100] (14 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54103] (18 PDB entries) |
![]() | Domain d1i4ma_: 1i4m A: [66025] swapped dimer complexed with cd, cl |
PDB Entry: 1i4m (more details), 2 Å
SCOPe Domain Sequences for d1i4ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i4ma_ d.6.1.1 (A:) Prion protein domain {Human (Homo sapiens) [TaxId: 9606]} gavvgglggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhd cvnitikqhtvttttkgenftetdvkmmervveqmcitqyeresqayy
Timeline for d1i4ma_: