Lineage for d1hywa_ (1hyw A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879656Fold d.186: gpW/XkdW-like [64209] (2 superfamilies)
    alpha-beta(2)-alpha; antiparallel hairpin
  4. 879657Superfamily d.186.1: Head-to-tail joining protein W, gpW [64210] (1 family) (S)
  5. 879658Family d.186.1.1: Head-to-tail joining protein W, gpW [64211] (1 protein)
  6. 879659Protein Head-to-tail joining protein W, gpW [64212] (1 species)
  7. 879660Species Bacteriophage lambda [TaxId:10710] [64213] (1 PDB entry)
  8. 879661Domain d1hywa_: 1hyw A: [61425]

Details for d1hywa_

PDB Entry: 1hyw (more details)

PDB Description: solution structure of bacteriophage lambda gpw
PDB Compounds: (A:) head-to-tail joining protein w

SCOP Domain Sequences for d1hywa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hywa_ d.186.1.1 (A:) Head-to-tail joining protein W, gpW {Bacteriophage lambda [TaxId: 10710]}
mtrqeelaaaraalhdlmtgkrvatvqkdgrrveftatsvsdlkkyiaelevqtgmtq

SCOP Domain Coordinates for d1hywa_:

Click to download the PDB-style file with coordinates for d1hywa_.
(The format of our PDB-style files is described here.)

Timeline for d1hywa_: