Lineage for d1hy7b_ (1hy7 B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies)
contains mixed beta sheet with connection over free side of the sheetSuperfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) 
Protein Stromelysin-1 (MMP-3) [55536] (1 species) Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (40 PDB entries) 
Domain d1hy7b_: 1hy7 B: [65958]
complexed with ca, mbs, zn
Details for d1hy7b_
PDB Entry: 1hy7 (more details), 1.5 Å
PDB Description: a carboxylic acid based inhibitor in complex with mmp3
PDB Compounds: (B:) stromelysin-1SCOPe Domain Sequences for d1hy7b_:
Sequence, based on SEQRES records: (download)
>d1hy7b_ d.92.1.11 (B:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdspet
Sequence, based on observed residues (ATOM records): (download)
>d1hy7b_ d.92.1.11 (B:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyltdltrfrlsqddingiqslygpppdspet
SCOPe Domain Coordinates for d1hy7b_:
Click to download the PDB-style file with coordinates for d1hy7b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hy7b_:
- d1hy7b_ first appeared in SCOP 1.59
- d1hy7b_ appears in SCOPe 2.04
- d1hy7b_ appears in SCOPe 2.06
- d1hy7b_ appears in the current release, SCOPe 2.08
View in 3D
