Lineage for d1hxga1 (1hxg A:15-220)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) 
Family a.102.4.1: Terpenoid cyclase N-terminal domain [48240] (3 proteins)
incomplete toroid made of four hairpins
automatically mapped to Pfam PF01397
Protein 5-Epi-aristolochene synthase [48241] (1 species) Species Tobacco (Nicotiana tabacum) [TaxId:4097] [48242] (7 PDB entries) 
Domain d1hxga1: 1hxg A:15-220 [83645]
Other proteins in same PDB: d1hxga2
complexed with mg
Details for d1hxga1
PDB Entry: 1hxg (more details), 2.9 Å
PDB Description: crystal structure of teas w273s/c440w
PDB Compounds: (A:) 5-epi-aristolochene synthaseSCOPe Domain Sequences for d1hxga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hxga1 a.102.4.1 (A:15-220) 5-Epi-aristolochene synthase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
rpvadfspslwgdqflsfsidnqvaekyakeiealkeqtrnmllatgmkladtlnlidti
erlgisyhfekeiddildqiynqnsncndlctsalqfrllrqhgfnispeifskfqdeng
kfkeslasdvlgllnlyeashvrthaddiledalafstihlesaaphlksplreqvthal
eqclhkgvprvetrffissiydkeqs
SCOPe Domain Coordinates for d1hxga1:
Click to download the PDB-style file with coordinates for d1hxga1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hxga1:
- d1hxga1 first appeared in SCOP 1.65
- d1hxga1 appears in SCOPe 2.03
- d1hxga1 appears in SCOPe 2.05
- d1hxga1 appears in the current release, SCOPe 2.08
View in 3D
