![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) ![]() |
![]() | Family a.102.4.1: Terpenoid cyclase N-terminal domain [48240] (3 proteins) incomplete toroid made of four hairpins automatically mapped to Pfam PF01397 |
![]() | Protein 5-Epi-aristolochene synthase [48241] (1 species) |
![]() | Species Tobacco (Nicotiana tabacum) [TaxId:4097] [48242] (7 PDB entries) |
![]() | Domain d1hxga1: 1hxg A:15-220 [83645] Other proteins in same PDB: d1hxga2 complexed with mg |
PDB Entry: 1hxg (more details), 2.9 Å
SCOPe Domain Sequences for d1hxga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hxga1 a.102.4.1 (A:15-220) 5-Epi-aristolochene synthase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} rpvadfspslwgdqflsfsidnqvaekyakeiealkeqtrnmllatgmkladtlnlidti erlgisyhfekeiddildqiynqnsncndlctsalqfrllrqhgfnispeifskfqdeng kfkeslasdvlgllnlyeashvrthaddiledalafstihlesaaphlksplreqvthal eqclhkgvprvetrffissiydkeqs
Timeline for d1hxga1: