Lineage for d1hnja1 (1hnj A:1-174)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916987Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)
  6. 2917122Protein Ketoacyl-ACP synthase III (FabH) [53912] (5 species)
  7. 2917126Species Escherichia coli [TaxId:562] [53913] (14 PDB entries)
  8. 2917127Domain d1hnja1: 1hnj A:1-174 [35969]
    complexed with mlc, po4

Details for d1hnja1

PDB Entry: 1hnj (more details), 1.46 Å

PDB Description: crystal structure of beta-ketoacyl-acp synthase iii + malonyl-coa
PDB Compounds: (A:) beta-ketoacyl-acyl carrier protein synthase III

SCOPe Domain Sequences for d1hnja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnja1 c.95.1.2 (A:1-174) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]}
mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgi

SCOPe Domain Coordinates for d1hnja1:

Click to download the PDB-style file with coordinates for d1hnja1.
(The format of our PDB-style files is described here.)

Timeline for d1hnja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hnja2