Lineage for d1hn4b_ (1hn4 B:)
- Root: SCOP 1.73
Class a: All alpha proteins [46456] (258 folds) Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
common core: 2 helices, disulfide-linked, and a calcium-binding loopSuperfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) 
Protein Phospholipase A2 [48637] (4 species) 
Species Pig (Sus scrofa), pancreas [TaxId:9823] [48640] (19 PDB entries) 
Domain d1hn4b_: 1hn4 B: [65894]
complexed with ca, mji, so4
Details for d1hn4b_
PDB Entry: 1hn4 (more details), 1.5 Å
PDB Description: prophospholipase a2 dimer complexed with mj33, sulfate, and calcium
PDB Compounds: (B:) prophospholipase a2SCOP Domain Sequences for d1hn4b_:
Sequence, based on SEQRES records: (download)
>d1hn4b_ a.133.1.2 (B:) Phospholipase A2 {Pig (Sus scrofa), pancreas [TaxId: 9823]}
qegissralwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyr
daknldsckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynk
ehknldtkkyc
Sequence, based on observed residues (ATOM records): (download)
>d1hn4b_ a.133.1.2 (B:) Phospholipase A2 {Pig (Sus scrofa), pancreas [TaxId: 9823]}
qegissralwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyr
daknldsckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynk
ehknldc
SCOP Domain Coordinates for d1hn4b_:
Click to download the PDB-style file with coordinates for d1hn4b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hn4b_:
- d1hn4b_ first appeared in SCOP 1.59
- d1hn4b_ appears in SCOP 1.71
- d1hn4b_ appears in SCOP 1.75
- d1hn4b_ appears in the current release, SCOPe 2.08
View in 3D
