Lineage for d1hlua1 (1hlu A:2-146)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) 
duplication contains two domains of this fold
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) 
Protein Actin [53073] (7 species) 
Species Cow (Bos taurus) [TaxId:9913] [53074] (3 PDB entries) 
Domain d1hlua1: 1hlu A:2-146 [33431]
Other proteins in same PDB: d1hlup_
complexed with atp, ca
Details for d1hlua1
PDB Entry: 1hlu (more details), 2.65 Å
PDB Description: structure of bovine beta-actin-profilin complex with actin bound atp phosphates solvent accessible
PDB Compounds: (A:) beta-actinSCOPe Domain Sequences for d1hlua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hlua1 c.55.1.1 (A:2-146) Actin {Cow (Bos taurus) [TaxId: 9913]}
dddiaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqsk
rgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtq
imfetfntpamyvaiqavlslyasg
SCOPe Domain Coordinates for d1hlua1:
Click to download the PDB-style file with coordinates for d1hlua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hlua1:
- d1hlua1 first appeared (with stable ids) in SCOP 1.55
- d1hlua1 appears in SCOPe 2.03
- d1hlua1 appears in SCOPe 2.05
- d1hlua1 appears in the current release, SCOPe 2.08
View in 3D
