Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
Superfamily c.50.1: Macro domain-like [52949] (3 families) |
Family c.50.1.2: Macro domain [89724] (7 proteins) found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme |
Protein Hypothetical protein AF1521 [89725] (1 species) contains extra N-terminal strand |
Species Archaeoglobus fulgidus [TaxId:2234] [89726] (4 PDB entries) Uniprot O28751 |
Domain d1hjza_: 1hjz A: [83520] complexed with mes |
PDB Entry: 1hjz (more details), 1.7 Å
SCOPe Domain Sequences for d1hjza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hjza_ c.50.1.2 (A:) Hypothetical protein AF1521 {Archaeoglobus fulgidus [TaxId: 2234]} mevlfeakvgditlklaqgditqypakaivnaankrlehgggvayaiakacagdaglyte iskkamreqfgrdyidhgevvvtpamnleergikyvfhtvgpicsgmwseelkeklykaf lgplekaeemgvesiafpavsagiygcdlekvvetfleavknfkgsavkevalviydrks aevalkvfersl
Timeline for d1hjza_: