Lineage for d1hjza_ (1hjz A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1856004Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 1856005Superfamily c.50.1: Macro domain-like [52949] (3 families) (S)
  5. 1856030Family c.50.1.2: Macro domain [89724] (7 proteins)
    found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme
  6. 1856047Protein Hypothetical protein AF1521 [89725] (1 species)
    contains extra N-terminal strand
  7. 1856048Species Archaeoglobus fulgidus [TaxId:2234] [89726] (4 PDB entries)
    Uniprot O28751
  8. 1856051Domain d1hjza_: 1hjz A: [83520]
    complexed with mes

Details for d1hjza_

PDB Entry: 1hjz (more details), 1.7 Å

PDB Description: crystal structure of af1521 protein containing a macroh2a domain
PDB Compounds: (A:) hypothetical protein af1521

SCOPe Domain Sequences for d1hjza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjza_ c.50.1.2 (A:) Hypothetical protein AF1521 {Archaeoglobus fulgidus [TaxId: 2234]}
mevlfeakvgditlklaqgditqypakaivnaankrlehgggvayaiakacagdaglyte
iskkamreqfgrdyidhgevvvtpamnleergikyvfhtvgpicsgmwseelkeklykaf
lgplekaeemgvesiafpavsagiygcdlekvvetfleavknfkgsavkevalviydrks
aevalkvfersl

SCOPe Domain Coordinates for d1hjza_:

Click to download the PDB-style file with coordinates for d1hjza_.
(The format of our PDB-style files is described here.)

Timeline for d1hjza_: