SCOPe 2.05: Domain d1hjzb_: 1hjz B:

Lineage for d1hjzb_ (1hjz B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (3 families)

5. Family c.50.1.2: Macro domain [89724] (7 proteins)
   found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme

6. Protein Hypothetical protein AF1521 [89725] (1 species)
   contains extra N-terminal strand

7. Species Archaeoglobus fulgidus [TaxId:2234] [89726] (4 PDB entries)
   Uniprot O28751

8. Domain d1hjzb_: 1hjz B: [83521]
   complexed with mes

Details for d1hjzb_

PDB Entry: 1hjz, 1.7 Å

PDB Description: crystal structure of af1521 protein containing a macroh2a domain

PDB Compounds: (B:) hypothetical protein af1521

SCOPe Domain Sequences for d1hjzb_:

Sequence; same for both SEQRES and ATOM records:

>d1hjzb_ c.50.1.2 (B:) Hypothetical protein AF1521 {Archaeoglobus fulgidus [TaxId: 2234]}
mevlfeakvgditlklaqgditqypakaivnaankrlehgggvayaiakacagdaglyte
iskkamreqfgrdyidhgevvvtpamnleergikyvfhtvgpicsgmwseelkeklykaf
lgplekaeemgvesiafpavsagiygcdlekvvetfleavknfkgsavkevalviydrks
aevalkvfersl

Timeline for d1hjzb_:

• d1hjzb_ first appeared in SCOP 1.65
  
• d1hjzb_ appears in SCOPe 2.04
  
• d1hjzb_ appears in SCOPe 2.06
  
• d1hjzb_ appears in the current release, SCOPe 2.08