Lineage for d1heka_ (1hek A:)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
4-5 helices; right-handed superhelixSuperfamily a.61.1: Retroviral matrix proteins [47836] (6 families) 
the 5th, C-terminal helix is missing in some of the member structures
Family a.61.1.5: EIAV matrix antigen [69051] (1 protein) Protein EIAV matrix antigen [69052] (1 species) Species Equine infectious anemia virus, EIAV [TaxId:11665] [69053] (1 PDB entry) 
Domain d1heka_: 1hek A: [65818]
Details for d1heka_
PDB Entry: 1hek (more details), 2.8 Å
PDB Description: crystal structure of equine infectious anaemia virus matrix antigen (eiav ma)
PDB Compounds: (A:) gag polyprotein, core protein p15SCOP Domain Sequences for d1heka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1heka_ a.61.1.5 (A:) EIAV matrix antigen {Equine infectious anemia virus, EIAV [TaxId: 11665]}
amadigsmgdpltwskalkklekvtvqgsqklttgncnwalslvdlfhdtnfvkekdwql
rdviplledvtqtlsgqereafertwwaisavkmglqinnvvdgkasfqllrakye
SCOP Domain Coordinates for d1heka_:
Click to download the PDB-style file with coordinates for d1heka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1heka_:
- d1heka_ first appeared in SCOP 1.59
- d1heka_ appears in SCOP 1.73
- d1heka_ appears in SCOPe 2.01
- d1heka_ appears in the current release, SCOPe 2.08, called d1heka1
View in 3D
