Lineage for d1heia2 (1hei A:326-629)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.14: RNA helicase [52724] (4 proteins)
duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
Protein HCV helicase domain [52725] (1 species) Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (17 PDB entries) 
Domain d1heia2: 1hei A:326-629 [32464]
complexed with ca
Details for d1heia2
PDB Entry: 1hei (more details), 2.1 Å
PDB Description: structure of the hepatitis c virus rna helicase domain
PDB Compounds: (A:) hcv helicaseSCOPe Domain Sequences for d1heia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1heia2 c.37.1.14 (A:326-629) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
pgsvtvshpnieevalsttgeipfygkaiplevikggrhlifchskkkcdelaaklvalg
inavayyrgldvsviptngdvvvvstdalmtgftgdfdsvidcntcvtqtvdfsldptft
ietttlpqdavsrtqrrgrtgrgkpgiyrfvapgerpsgmfdssvlcecydagcawyelm
paettvrlraymntpglpvcqdhlefwegvftglthidahflsqtkqsgenfpylvayqa
tvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqnevtlthpitkyimtcmsa
dlev
SCOPe Domain Coordinates for d1heia2:
Click to download the PDB-style file with coordinates for d1heia2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1heia2:
- d1heia2 first appeared (with stable ids) in SCOP 1.55
- d1heia2 appears in SCOPe 2.03
- d1heia2 appears in SCOPe 2.05
- d1heia2 appears in the current release, SCOPe 2.08
View in 3D
