Lineage for d1h8ub_ (1h8u B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607280Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2607341Protein Eosinophil major basic protein [64457] (1 species)
  7. 2607342Species Human (Homo sapiens) [TaxId:9606] [64458] (2 PDB entries)
  8. 2607344Domain d1h8ub_: 1h8u B: [60794]
    complexed with gol, so4

Details for d1h8ub_

PDB Entry: 1h8u (more details), 1.8 Å

PDB Description: crystal structure of the eosinophil major basic protein at 1.8a: an atypical lectin with a paradigm shift in specificity
PDB Compounds: (B:) eosinophil granule major basic protein 1

SCOPe Domain Sequences for d1h8ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8ub_ d.169.1.1 (B:) Eosinophil major basic protein {Human (Homo sapiens) [TaxId: 9606]}
cryllvrslqtfsqawftcrrcyrgnlvsihnfninyriqcsvsalnqgqvwiggritgs
grcrrfqwvdgsrwnfaywaahqpwsrgghcvalctrggywrrahclrrlpficsy

SCOPe Domain Coordinates for d1h8ub_:

Click to download the PDB-style file with coordinates for d1h8ub_.
(The format of our PDB-style files is described here.)

Timeline for d1h8ub_: