Lineage for d1h8la1 (1h8l A:305-383)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) 
Fold b.3: Prealbumin-like [49451] (7 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strands to common fold
Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (2 families) 
Family b.3.2.1: Carboxypeptidase regulatory domain [49465] (2 proteins) Protein Carboxypeptidase D C-terminal domain [49466] (1 species) Species Crested duck (Lophonetta specularioides) [TaxId:8836] [49467] (2 PDB entries) 
Domain d1h8la1: 1h8l A:305-383 [65737]
Other proteins in same PDB: d1h8la2
complexed with gem, man, nag, so4, zn
Details for d1h8la1
PDB Entry: 1h8l (more details), 2.6 Å
PDB Description: duck carboxypeptidase d domain ii in complex with gemsa
PDB Compounds: (A:) carboxypeptidase gp180 residues 503-882SCOP Domain Sequences for d1h8la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8la1 b.3.2.1 (A:305-383) Carboxypeptidase D C-terminal domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]}
giwgfvldatdgrgilnatisvadinhpvttykdgdywrllvqgtykvtasargydpvtk
tvevdskggvqvnftlsrt
SCOP Domain Coordinates for d1h8la1:
Click to download the PDB-style file with coordinates for d1h8la1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h8la1:
- d1h8la1 first appeared in SCOP 1.59
- d1h8la1 appears in SCOP 1.73
- d1h8la1 appears in SCOPe 2.01
- d1h8la1 appears in the current release, SCOPe 2.08
View in 3D
