Lineage for d1h6ua2 (1h6u A:36-262)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
Superfamily c.10.2: L domain-like [52058] (9 families) 
less regular structure consisting of variable repeats
Family c.10.2.1: Internalin LRR domain [52059] (4 proteins)
capped at the N-end with a truncated EF-hand subdomain
this is a repeat family; one repeat unit is 2omx A:261-239 found in domain
Protein Internalin H [69431] (1 species) Species Listeria monocytogenes [TaxId:1639] [69432] (1 PDB entry) 
Domain d1h6ua2: 1h6u A:36-262 [65689]
Other proteins in same PDB: d1h6ua1
Details for d1h6ua2
PDB Entry: 1h6u (more details), 1.8 Å
PDB Description: internalin h: crystal structure of fused n-terminal domains.
PDB Compounds: (A:) internalin hSCOPe Domain Sequences for d1h6ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}
gsitqptainvifpdpalanaikiaagksnvtdtvtqadldgittlsafgtgvttiegvq
ylnnliglelkdnqitdlaplknltkitelelsgnplknvsaiaglqsiktldltstqit
dvtplaglsnlqvlyldlnqitnisplagltnlqylsignaqvsdltplanlsklttlka
ddnkisdisplaslpnlievhlknnqisdvsplantsnlfivtltnq
SCOPe Domain Coordinates for d1h6ua2:
Click to download the PDB-style file with coordinates for d1h6ua2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h6ua2:
- d1h6ua2 first appeared in SCOP 1.59
- d1h6ua2 appears in SCOPe 2.03
- d1h6ua2 appears in SCOPe 2.05
- d1h6ua2 appears in the current release, SCOPe 2.08
View in 3D
