Lineage for d1h1na_ (1h1n A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.3: beta-glycanases [51487] (27 proteins)
consist of a number of sequence families
Protein Endocellulase EngI [75066] (1 species) Species Thermoascus aurantiacus [TaxId:5087] [75067] (2 PDB entries) 
Domain d1h1na_: 1h1n A: [70855]
Details for d1h1na_
PDB Entry: 1h1n (more details), 1.12 Å
PDB Description: atomic resolution structure of the major endoglucanase from thermoascus aurantiacus
PDB Compounds: (A:) endo type cellulase engiSCOPe Domain Sequences for d1h1na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]}
akvfqwfgsnesgaefgsqnlpgvegkdyiwpdpntidtliskgmnifrvpfmmerlvpn
smtgspdpnyladliatvnaitqkgayavvdphnygryynsiisspsdfetfwktvasqf
asnplvifdtdneyhdmdqtlvlnlnqaaidgirsagatsqyifvegnswtgawtwtnvn
dnmksltdpsdkiiyemhqyldsdgsgtsatcvsstigqeritsatqwlrangkkgiige
faggadnvcetaitgmldymaqntdvwtgaiwwaagpwwgdyifsmepdngiayqqilpi
ltpyl
SCOPe Domain Coordinates for d1h1na_:
Click to download the PDB-style file with coordinates for d1h1na_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h1na_:
- d1h1na_ first appeared in SCOP 1.61
- d1h1na_ appears in SCOPe 2.06
- d1h1na_ appears in the current release, SCOPe 2.08
View in 3D
