Lineage for d1h03p2 (1h03 P:67-129)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034014Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 3034015Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 3034016Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 3034131Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)
  7. 3034132Species Human (Homo sapiens) [TaxId:9606] [90173] (19 PDB entries)
  8. 3034134Domain d1h03p2: 1h03 P:67-129 [83412]
    modules 3 and 4

Details for d1h03p2

PDB Entry: 1h03 (more details), 1.7 Å

PDB Description: human cd55 domains 3 & 4
PDB Compounds: (P:) complement decay-accelerating factor

SCOPe Domain Sequences for d1h03p2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h03p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}
iycpappqidngiiqgerdhygyrqsvtyacnkgftmigehsiyctvnndegewsgpppe
crg

SCOPe Domain Coordinates for d1h03p2:

Click to download the PDB-style file with coordinates for d1h03p2.
(The format of our PDB-style files is described here.)

Timeline for d1h03p2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h03p1