Lineage for d1h03p1 (1h03 P:5-66)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1703717Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 1703718Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 1703719Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 1703814Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)
  7. 1703815Species Human (Homo sapiens) [TaxId:9606] [90173] (18 PDB entries)
  8. 1703816Domain d1h03p1: 1h03 P:5-66 [83411]
    modules 3 and 4

Details for d1h03p1

PDB Entry: 1h03 (more details), 1.7 Å

PDB Description: human cd55 domains 3 & 4
PDB Compounds: (P:) complement decay-accelerating factor

SCOPe Domain Sequences for d1h03p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h03p1 g.18.1.1 (P:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}
kscpnpgeirngqidvpggilfgatisfscntgyklfgstssfclisgssvqwsdplpec
re

SCOPe Domain Coordinates for d1h03p1:

Click to download the PDB-style file with coordinates for d1h03p1.
(The format of our PDB-style files is described here.)

Timeline for d1h03p1:

1703816
d1h03p1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1h03p2