Lineage for d1gvna_ (1gvn A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724803Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1724887Superfamily a.8.2: Plasmid maintenance system epsilon/zeta, antidote epsilon subunit [81710] (1 family) (S)
    automatically mapped to Pfam PF08998
  5. 1724888Family a.8.2.1: Plasmid maintenance system epsilon/zeta, antidote epsilon subunit [81711] (2 proteins)
    dimeric
  6. 1724889Protein Plasmid maintenance system epsilon/zeta, antidote epsilon subunit [81712] (1 species)
  7. 1724890Species Streptococcus pyogenes [TaxId:1314] [81713] (1 PDB entry)
  8. 1724891Domain d1gvna_: 1gvn A: [76353]
    Other proteins in same PDB: d1gvnb_, d1gvnd_
    complexed with so4

Details for d1gvna_

PDB Entry: 1gvn (more details), 1.95 Å

PDB Description: crystal structure of the plasmid maintenance system epsilon/zeta: meachnism of toxin inactivation and toxin function
PDB Compounds: (A:) epsilon

SCOPe Domain Sequences for d1gvna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gvna_ a.8.2.1 (A:) Plasmid maintenance system epsilon/zeta, antidote epsilon subunit {Streptococcus pyogenes [TaxId: 1314]}
vtyektfeieiinelsasvynrvlnyvlnhelnkndsqllevnllnqlklakrvnlfdys
leelqavheywrsmnryskqvlnkekva

SCOPe Domain Coordinates for d1gvna_:

Click to download the PDB-style file with coordinates for d1gvna_.
(The format of our PDB-style files is described here.)

Timeline for d1gvna_: