Class a: All alpha proteins [46456] (286 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.2: Plasmid maintenance system epsilon/zeta, antidote epsilon subunit [81710] (1 family) automatically mapped to Pfam PF08998 |
Family a.8.2.1: Plasmid maintenance system epsilon/zeta, antidote epsilon subunit [81711] (2 proteins) dimeric |
Protein Plasmid maintenance system epsilon/zeta, antidote epsilon subunit [81712] (1 species) |
Species Streptococcus pyogenes [TaxId:1314] [81713] (1 PDB entry) |
Domain d1gvna_: 1gvn A: [76353] Other proteins in same PDB: d1gvnb_, d1gvnd_ complexed with so4 |
PDB Entry: 1gvn (more details), 1.95 Å
SCOPe Domain Sequences for d1gvna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gvna_ a.8.2.1 (A:) Plasmid maintenance system epsilon/zeta, antidote epsilon subunit {Streptococcus pyogenes [TaxId: 1314]} vtyektfeieiinelsasvynrvlnyvlnhelnkndsqllevnllnqlklakrvnlfdys leelqavheywrsmnryskqvlnkekva
Timeline for d1gvna_: