Lineage for d1gqya2 (1gqy A:322-475)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1610448Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 1610449Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families) (S)
  5. 1610450Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins)
  6. 1610455Protein UDP-N-acetylmuramate-alanine ligase MurC [82452] (2 species)
  7. 1610456Species Haemophilus influenzae [TaxId:727] [89727] (4 PDB entries)
  8. 1610461Domain d1gqya2: 1gqy A:322-475 [83306]
    Other proteins in same PDB: d1gqya1, d1gqya3, d1gqyb1, d1gqyb3
    complexed with acp, mg

Details for d1gqya2

PDB Entry: 1gqy (more details), 1.8 Å

PDB Description: murc - crystal structure of the enzyme from haemophilus influenzae complexed with amppcp
PDB Compounds: (A:) udp-n-acetylmuramate-l-alanine ligase

SCOPe Domain Sequences for d1gqya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqya2 c.59.1.1 (A:322-475) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]}
gagrrfdqlgefirpngkvrlvddyghhptevgvtikaaregwgdkrivmifqphrysrt
rdlfddfvqvlsqvdalimldvyaageapivgadskslcrsirnlgkvdpilvsdtsqlg
dvldqiiqdgdlilaqgagsvskisrglaeswkn

SCOPe Domain Coordinates for d1gqya2:

Click to download the PDB-style file with coordinates for d1gqya2.
(The format of our PDB-style files is described here.)

Timeline for d1gqya2: