Lineage for d1gqba_ (1gqb A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
barrel, partly open; n*=8, S*=10; one psi loopSuperfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) 
Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 proteins) 
Protein Cation-independent mannose-6-phosphate receptor (MIR-receptor) [63821] (3 species) Species Human (Homo sapiens) [TaxId:9606] [63822] (5 PDB entries) 
Domain d1gqba_: 1gqb A: [76277]
repeat 11, IGF-II binding domain
complexed with br
Details for d1gqba_
PDB Entry: 1gqb (more details), 1.8 Å
PDB Description: human mir-receptor, repeat 11
PDB Compounds: (A:) cation-independent mannose-6-phosphate receptorSCOPe Domain Sequences for d1gqba_:
Sequence, based on SEQRES records: (download)
>d1gqba_ b.64.1.1 (A:) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Human (Homo sapiens) [TaxId: 9606]}
hddcqvtnpstghlfdlsslsgragftaaysekglvymsicgenencppgvgacfgqtri
svgkankrlryvdqvlqlvykdgspcpsksglsyksvisfvcrpeagptnrpmlisldkq
tctlffswhtplace
Sequence, based on observed residues (ATOM records): (download)
>d1gqba_ b.64.1.1 (A:) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Human (Homo sapiens) [TaxId: 9606]}
hddcqvtnpstghlfdlsslsgragftaaysekglvymsicgenencppgvgacfgqtri
svgkankrlryvdqvlqlvykdgspcpsksglsyksvisfvcrpenrpmlisldkqtctl
ffswhtplace
SCOPe Domain Coordinates for d1gqba_:
Click to download the PDB-style file with coordinates for d1gqba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gqba_:
- d1gqba_ first appeared in SCOP 1.63
- d1gqba_ appears in SCOPe 2.07
View in 3D
