Lineage for d1gqbb_ (1gqb B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064666Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
    barrel, partly open; n*=8, S*=10; one psi loop
  4. 2064667Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) (S)
  5. 2064668Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 protein domains)
  6. 2064697Protein Cation-independent mannose-6-phosphate receptor (MIR-receptor) [63821] (3 species)
  7. 2064718Species Human (Homo sapiens) [TaxId:9606] [63822] (5 PDB entries)
  8. 2064723Domain d1gqbb_: 1gqb B: [76278]
    repeat 11, IGF-II binding domain
    complexed with br

Details for d1gqbb_

PDB Entry: 1gqb (more details), 1.8 Å

PDB Description: human mir-receptor, repeat 11
PDB Compounds: (B:) cation-independent mannose-6-phosphate receptor

SCOPe Domain Sequences for d1gqbb_:

Sequence, based on SEQRES records: (download)

>d1gqbb_ b.64.1.1 (B:) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Human (Homo sapiens) [TaxId: 9606]}
ddcqvtnpstghlfdlsslsgragftaaysekglvymsicgenencppgvgacfgqtris
vgkankrlryvdqvlqlvykdgspcpsksglsyksvisfvcrpeagptnrpmlisldkqt
ctlffswhtplace

Sequence, based on observed residues (ATOM records): (download)

>d1gqbb_ b.64.1.1 (B:) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Human (Homo sapiens) [TaxId: 9606]}
ddcqvtnpstghlfdlsslsgragftaaysekglvymsicgenencppgvgacfgqtris
vgkankrlryvdqvlqlvykdgspcpsksglsyksvisfvcrpenrpmlisldkqtctlf
fswhtplace

SCOPe Domain Coordinates for d1gqbb_:

Click to download the PDB-style file with coordinates for d1gqbb_.
(The format of our PDB-style files is described here.)

Timeline for d1gqbb_: