Lineage for d1gl4b_ (1gl4 B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 787055Family b.1.1.4: I set domains [49159] (38 proteins)
  6. 787362Protein Perlecan Ig3 domain [69158] (1 species)
  7. 787363Species Mouse (Mus musculus) [TaxId:10090] [69159] (1 PDB entry)
  8. 787364Domain d1gl4b_: 1gl4 B: [65288]
    Other proteins in same PDB: d1gl4a1, d1gl4a2
    complexed with epe, zn

Details for d1gl4b_

PDB Entry: 1gl4 (more details), 2 Å

PDB Description: nidogen-1 g2/perlecan ig3 complex
PDB Compounds: (B:) basement membrane-specific heparan sulfate proteoglycan core protein

SCOP Domain Sequences for d1gl4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]}
pimvtveeqrsqsvrpgadvtfictakskspaytlvwtrlhngklpsramdfngiltirn
vqpsdagtyvctgsnmfamdqgtatlhvq

SCOP Domain Coordinates for d1gl4b_:

Click to download the PDB-style file with coordinates for d1gl4b_.
(The format of our PDB-style files is described here.)

Timeline for d1gl4b_: