Class a: All alpha proteins [46456] (286 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
Protein Phospholipase A2 [48637] (5 species) |
Species Cow (Bos taurus), pancreas [TaxId:9913] [48639] (32 PDB entries) Uniprot P00593 |
Domain d1gh4a_: 1gh4 A: [60516] complexed with ca, mpd; mutant |
PDB Entry: 1gh4 (more details), 1.9 Å
SCOPe Domain Sequences for d1gh4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gh4a_ a.133.1.2 (A:) Phospholipase A2 {Cow (Bos taurus), pancreas [TaxId: 9913]} alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncykqamklds ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldm mnc
Timeline for d1gh4a_: