Lineage for d1g65f_ (1g65 F:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1222614Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1222615Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1222781Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1222883Protein Proteasome alpha subunit (non-catalytic) [56255] (6 species)
    contains an extension to the common fold at the N-terminus
  7. 1222899Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (37 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1223022Domain d1g65f_: 1g65 F: [41965]
    Other proteins in same PDB: d1g651_, d1g652_, d1g65h_, d1g65i_, d1g65j_, d1g65k_, d1g65l_, d1g65m_, d1g65n_, d1g65v_, d1g65w_, d1g65x_, d1g65y_, d1g65z_
    different sequences
    complexed with mg

Details for d1g65f_

PDB Entry: 1g65 (more details), 2.25 Å

PDB Description: Crystal structure of epoxomicin:20s proteasome reveals a molecular basis for selectivity of alpha,beta-epoxyketone proteasome inhibitors
PDB Compounds: (F:) Proteasome component C1

SCOPe Domain Sequences for d1g65f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g65f_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
kein

SCOPe Domain Coordinates for d1g65f_:

Click to download the PDB-style file with coordinates for d1g65f_.
(The format of our PDB-style files is described here.)

Timeline for d1g65f_: