Lineage for d1ft1b_ (1ft1 B:)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) 
Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins) Protein Protein farnesyltransferase, beta-subunit [48247] (2 species) 
Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (50 PDB entries)
Uniprot Q02293 22-418 P53610
Domain d1ft1b_: 1ft1 B: [18867]
Other proteins in same PDB: d1ft1a_
complexed with zn
Details for d1ft1b_
PDB Entry: 1ft1 (more details), 2.25 Å
PDB Description: crystal structure of protein farnesyltransferase at 2.25 angstroms resolution
PDB Compounds: (B:) protein farnesyltransferaseSCOPe Domain Sequences for d1ft1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ft1b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
plyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhy
lkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfg
ggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdv
rsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvi
lkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdp
alsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgam
lhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgfeecedavtsdpatd
SCOPe Domain Coordinates for d1ft1b_:
Click to download the PDB-style file with coordinates for d1ft1b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ft1b_:
- d1ft1b_ first appeared (with stable ids) in SCOP 1.55
- d1ft1b_ appears in SCOPe 2.03
- d1ft1b_ appears in SCOPe 2.05
- d1ft1b_ appears in the current release, SCOPe 2.08
View in 3D
