![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) ![]() |
![]() | Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins) |
![]() | Protein Protein farnesyltransferase, beta-subunit [48247] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (50 PDB entries) Uniprot Q02293 22-418 P53610 |
![]() | Domain d1ft1b_: 1ft1 B: [18867] Other proteins in same PDB: d1ft1a_ complexed with zn |
PDB Entry: 1ft1 (more details), 2.25 Å
SCOPe Domain Sequences for d1ft1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ft1b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]} plyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhy lkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfg ggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdv rsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvi lkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdp alsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgam lhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgfeecedavtsdpatd
Timeline for d1ft1b_: