Lineage for d1fl1a_ (1fl1 A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.57: Herpes virus serine proteinase, assemblin [50788] (1 superfamily)
core: barrel, closed; n=7, S=8; complex topologySuperfamily b.57.1: Herpes virus serine proteinase, assemblin [50789] (2 families) 
automatically mapped to Pfam PF00716Family b.57.1.1: Herpes virus serine proteinase, assemblin [50790] (5 proteins) Protein KSHV protease [50795] (1 species) Species Kaposi's sarcoma-associated herpesvirus [TaxId:37296] [50796] (2 PDB entries) 
Domain d1fl1a_: 1fl1 A: [27023]
complexed with k
Details for d1fl1a_
PDB Entry: 1fl1 (more details), 2.2 Å
PDB Description: kshv protease
PDB Compounds: (A:) ProteaseSCOPe Domain Sequences for d1fl1a_:
Sequence, based on SEQRES records: (download)
>d1fl1a_ b.57.1.1 (A:) KSHV protease {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]}
aqglyvggfvdvvscpkleqelyldpdqvtdylpvteplpitiehlpetevgwtlglfqv
shgifctgaitspaflelasrladtshvarapvknlpkeplleilhtwlpglslssihpr
elsqtpsgpvfqhvslcalgrrrgtvavyghdaewvvsrfssvskserahilqhvsscrl
edlstpnfvspletlmakaidagfirdrldllktdrgvasilspvylka
Sequence, based on observed residues (ATOM records): (download)
>d1fl1a_ b.57.1.1 (A:) KSHV protease {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]}
aqglyvggfvdvvseplpitiehlpetevgwtlglfqvshgifctgaitspaflelasrl
adtshvarapvknlpkeplleilhtwlpglslsfqhvslcalgrrrgtvavyghdaewvv
srfssvskserahilqhvsscrledlstpnfvspletlmakaidagfirdrldllktdrg
vasilspvylka
SCOPe Domain Coordinates for d1fl1a_:
Click to download the PDB-style file with coordinates for d1fl1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fl1a_:
- d1fl1a_ first appeared (with stable ids) in SCOP 1.55
- d1fl1a_ appears in SCOPe 2.07
View in 3D
