Class b: All beta proteins [48724] (180 folds) |
Fold b.57: Herpes virus serine proteinase, assemblin [50788] (1 superfamily) core: barrel, closed; n=7, S=8; complex topology |
Superfamily b.57.1: Herpes virus serine proteinase, assemblin [50789] (2 families) automatically mapped to Pfam PF00716 |
Family b.57.1.1: Herpes virus serine proteinase, assemblin [50790] (5 proteins) |
Protein KSHV protease [50795] (1 species) |
Species Kaposi's sarcoma-associated herpesvirus [TaxId:37296] [50796] (2 PDB entries) |
Domain d1fl1b_: 1fl1 B: [27024] complexed with k |
PDB Entry: 1fl1 (more details), 2.2 Å
SCOPe Domain Sequences for d1fl1b_:
Sequence, based on SEQRES records: (download)
>d1fl1b_ b.57.1.1 (B:) KSHV protease {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]} aqglyvggfvdvvscpkleqelyldpdqvtdylpvteplpitiehlpetevgwtlglfqv shgifctgaitspaflelasrladtshvarapvknlpkeplleilhtwlpglslssihpr elsqtpsgpvfqhvslcalgrrrgtvavyghdaewvvsrfssvskserahilqhvsscrl edlstpnfvspletlmakaidagfirdrldllktdrgvasilspvylka
>d1fl1b_ b.57.1.1 (B:) KSHV protease {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]} aqglyvggfvdvvdqvtdylpvteplpitiehlpetevgwtlglfqvshgifctgaitsp aflelasrladtshvarapvknlpkeplleilhtwlpglslssihppvfqhvslcalgrr rgtvavyghdaewvvsrfssvskserahilqhvsscrledlstpnfvspletlmakaida gfirdrldllktdrgvasilspvylka
Timeline for d1fl1b_: